biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:50-1:200
immunogen sequence
DFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPV
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... NFATC2(4773)
General description
NFATC2 (nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2) is a member of the nuclear factor family called NFAT. It is expressed in peripheral T-cells, as well as cells not belonging to the immune system. It is a heavily phosphorylated protein. It was first recognized as a regulator of transcription, influencing the proliferation and migration of T-cells.
Immunogen
Nuclear factor of activated T-cells, cytoplasmic 2 recombinant protein epitope signature tag (PrEST)
Application
Anti-NFATC2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)
Immunohistochemistry (1 paper)
Western Blotting (1 paper)
Biochem/physiol Actions
NFATC2 (nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2) is dephosphorylated and induced by calcineurin, which is a phosphatase. It is up-regulated in glioblastoma multiforme (GBM), where it leads to elevated expression of interleukin-13 receptor α2subunit (IL-13Rα2). In GBM, this protein facilitates the invasiveness of the tumor by activating multiple invasion-promoting genes, such as matrix metalloproteinase-7 (MMP7), MMP9 and COX2 (cyclooxygenase 2). This protein is constitutively expressed in melanoma, and its expression is suppressed on treatment with cyclosporin A, which results in death of neoplastic cells. Thus, this protein has potential as a therapeutic target in melanoma.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST70871
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
存储类别
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
法规信息
新产品
此项目有
相关内容
Prestige Antibodies Immunofluorescence Procedure
Xinxin Tie et al.
PloS one, 8(6), e66008-e66008 (2013-06-14)
Members of the nuclear factor of activated T cells (NFAT) family have been identified as regulators of oncogenic transformation in several human malignancies. A prominent member of this family, NFAT1, is associated with tumor cell survival, apoptosis, migration and invasion.
Orla Maguire et al.
Cytometry. Part A : the journal of the International Society for Analytical Cytology, 83(12), 1096-1104 (2013-10-19)
Nuclear factor of activated T cells (NFAT) is a family of transcription factors involved in regulating the immune response. The canonical NFAT pathway is calcium-dependent and upon activation, NFAT is dephosphorylated by the phosphatase, calcineurin. This results in its translocation
Matthias Weider et al.
Nature communications, 9(1), 899-899 (2018-03-04)
Oligodendrocytes produce myelin for rapid transmission and saltatory conduction of action potentials in the vertebrate central nervous system. Activation of the myelination program requires several transcription factors including Sox10, Olig2, and Nkx2.2. Functional interactions among them are poorly understood and
全球贸易项目编号
| 货号 | GTIN |
|---|---|
| HPA008789-100UL | 04061837124884 |
| HPA008789-25UL | 04061842797257 |