Anti-SRD5A2, (N-terminal) antibody produced in rabbit

Steroid 5α-reductase type 2 (SRD5A2) enzyme is expressed in the male reproductory system and contains an N-terminal testosterone-binding domain and a C-terminal nicotinamide adenine dinucleotide phosphate (NADPH)-binding domain. The SRD5A2 gene is mapped on the human chromosome at 2p23.1.

Synthetic peptide directed towards the N terminal region of human SRD5A2

Steroid 5α-reductase type 2 (SRD5A2) enzyme mediates the conversion of testosterone to dihydrotestosterone (DHT). Mutations in the SRD5A2 gene are associated with an autosomal recessive form of 46, XY differences disorders of sexual development (DSD) in males characterized by underdeveloped and atypical genitalia. Overexpression of the SRD5A2 gene is associated with androgenic alopecia, benign prostatic hyperplasia (BPH), and prostate cancer. This gene is expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudo-hermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Synthetic peptide located within the following region: KHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLL

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.