Monoclonal Anti-FTCD antibody produced in mouse

FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.(supplied by OMIM) Formimidoyltransferase cyclodeaminase (FTCD) gene is localized in human fetal and adult liver. The gene is located on human chromosome 21q22.3.

FTCD (NP_996848, 440 a.a. ~ 541 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

Monoclonal Anti-FTCD antibody produced in mouse has been used in indirect immunofluorescence staining, immunohistochemistry and immunocytochemistry.

Formimidoyltransferase cyclodeaminase (FTCD) deficiency is associated with formiminoglutamic aciduria. FTCD is considered as a therapeutic target for hepatocellular carcinoma (HCC). Mutations in FTCD is linked to glutamate formiminotransferase deficiency.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.