Monoclonal Anti-PTEN antibody produced in mouse

Phosphatase and tensin homolog (PTEN) is a tumor-suppressor gene. It encodes for a phosphatase which possesses a tensin-like domain, a catalytic domain and a 220-amino acid carboxy-terminal region. The PTEN gene is localized on human chromosome 10q23.3.

PTEN (AAH05821, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTL

Monoclonal Anti-PTEN antibody produced in mouse has been used in Western Blotting.

Phosphatase and tensin homolog (PTEN) is a negative regulator of the phosphoinositide 3-kinase (PI3K) pathway. It de-phosphorylates phosphatidylinositol-[3, 4, 5]-tri-phosphate (PIP3). PTEN also has roles in cell growth, proliferation, control of cell cycle and apoptosis. It has been associated with gastric and breast cancers.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.