Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC, WB
Citations:
7
Product Name
Anti-OLIG2 (AB2) antibody produced in rabbit, affinity isolated antibody
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
32 kDa
species reactivity
rat, human, mouse, dog, guinea pig, horse
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable, western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... OLIG2(10215)
General description
OLIG2 is a basic helix-loop-helix (bHLH) transcription factor that is expressed in the spinal cord. This transcription factor is involved in the development of oligodendrocytes and motor neurons. OLIG2 may be useful as a diagnostic marker of oligodendroglial cancer.
Rabbit Anti-OLIG2 (AB2) antibody recognizes chicken, human, mouse, rat, and bovine OLIG2.
Rabbit Anti-OLIG2 (AB2) antibody recognizes chicken, human, mouse, rat, and bovine OLIG2.
Immunogen
Synthetic peptide directed towards the N terminal region of human OLIG2
Application
Rabbit Anti-OLIG2 (AB2) antibody is suitable for use in western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions
OLIG2 is a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. OLIG2 is an essential regulator of ventral neuroectodermal progenitor cell fate. It is associated with T-cell acute lymphoblastic leukemia due to a chromosomal translocation t(14;21)(q11.2;q22). OLIG2 might play a role in learning deficits associated with Down syndrome.This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Explore all of our products under Anti-OLIG2 (AB2) antibody produced in rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
低风险生物材料
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Y Marie et al.
Lancet (London, England), 358(9278), 298-300 (2001-08-11)
OLIG2 is a recently identified transcription factor involved in the specification of cells in the oligodendroglial lineage. We investigated the expression of OLIG2 by in-situ hybridisation in 21 brain tumours: nine grade II and III oligodendrogliomas, three grade II oligoastrocytomas
Qiao Zhou et al.
Cell, 109(1), 61-73 (2002-04-17)
OLIG1 and OLIG2 are basic-helix-loop-helix (bHLH) transcription factors expressed in the pMN domain of the spinal cord, which sequentially generates motoneurons and oligodendrocytes. In Olig1/2 double-mutant mice, motoneurons are largely eliminated, and oligodendrocyte differentiation is abolished. Lineage tracing data suggest
Christian Gonzalez et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(33), 10924-10936 (2014-08-15)
Glioma growth is driven by signaling that ultimately regulates protein synthesis. Gliomas are also complex at the cellular level and involve multiple cell types, including transformed and reactive cells in the brain tumor microenvironment. The distinct functions of the various
Global Trade Item Number
| SKU | GTIN |
|---|---|
| AV31464-100UL | 04061836189808 |